Lineage for d4tx3a_ (4tx3 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005530Species Actinoplanes teichomyceticus [TaxId:1867] [189592] (5 PDB entries)
  8. 2005534Domain d4tx3a_: 4tx3 A: [269901]
    automated match to d1f25a_
    complexed with edo, hem, so4

Details for d4tx3a_

PDB Entry: 4tx3 (more details), 2.5 Å

PDB Description: complex of the x-domain and oxyb from teicoplanin biosynthesis
PDB Compounds: (A:) OxyB protein

SCOPe Domain Sequences for d4tx3a_:

Sequence, based on SEQRES records: (download)

>d4tx3a_ a.104.1.0 (A:) automated matches {Actinoplanes teichomyceticus [TaxId: 1867]}
sppihtrrqgfdpadelraagtltkisigsgadaettwlaaghavvrqvlgdhkrfstrr
rfdrrdeiggtgvfrprelvgnlmdydppehtrlrhlltpgftqrrmrrlaprieeivtd
rldameqagppadlielfadevpgavlceligvprddqamflqlchrhldaslsarkraa
ageafarylvammarerkdpgdgfigsivaehgdtitdeelrgvcvqlmlagddnvsgmi
glgvlallrhpeqiaalrgddqsadravdeliryltvpyaptprtavedvmvadqvikeg
etvlcslpmanrdrallpdadrldvtrtpvphvafghgihhclgaaltrlqlriaytalw
rrfpalqladpaqeimfrtstpaygltsllvaw

Sequence, based on observed residues (ATOM records): (download)

>d4tx3a_ a.104.1.0 (A:) automated matches {Actinoplanes teichomyceticus [TaxId: 1867]}
sppihtrrqgfdpadelraagtltkisttwlaaghavvrqvlgdhkrfstrrvfrprelv
gnlmdydppehtrlrhlltpgftqrrmrrlaprieeivtdrldameqagppadlielfad
evpgavlceligvprddqamflqlchrhldaslsarkraaageafarylvammarerkdp
gdgfigsivaehgdtitdeelrgvcvqlmlagddnvsgmiglgvlallrhpeqiaalrgd
dqsadravdeliryltvpyaptprtavedvmvadqvikegetvlcslpmanrdrallpda
drldvtrtpvphvafghgihhclgaaltrlqlriaytalwrrfpalqladpaqeimfrts
tpaygltsllvaw

SCOPe Domain Coordinates for d4tx3a_:

Click to download the PDB-style file with coordinates for d4tx3a_.
(The format of our PDB-style files is described here.)

Timeline for d4tx3a_: