![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins) Pfam PF00640 |
![]() | Protein Insulin receptor substrate 1, IRS-1 [50758] (1 species) duplication: contains two domains of this fold |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50759] (2 PDB entries) |
![]() | Domain d1qqgb2: 1qqg B:159-264 [26990] |
PDB Entry: 1qqg (more details), 2.3 Å
SCOPe Domain Sequences for d1qqgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qqgb2 b.55.1.2 (B:159-264) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} afkevwqvilkpkglgqtknligiyrlcltsktisfvklnseaaavvlqlmnirrcghse nfffievgrsavtgpgefwmqvddsvvaqnmhetileamramsdef
Timeline for d1qqgb2: