| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d4s1df1: 4s1d F:1-107 [269899] Other proteins in same PDB: d4s1dc_, d4s1dd2, d4s1de_, d4s1df2, d4s1dh_, d4s1dl2, d4s1do_, d4s1dp2 automated match to d1h3pl1 complexed with 41m, so4 |
PDB Entry: 4s1d (more details), 2.5 Å
SCOPe Domain Sequences for d4s1df1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4s1df1 b.1.1.0 (F:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspaslsasvgetvtitcrasgnihnylswfqqkqgkspqllvysaktladgvps
rfsgsgsgtqyslkinslqpedfgtyycqhfwssiytfgggtkleik
Timeline for d4s1df1: