SCOPe 2.08: Domain d4s1dp2: 4s1d P:108-210

Lineage for d4s1dp2 (4s1d P:108-210)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
Domain d4s1dp2: 4s1d P:108-210 [269898]
Other proteins in same PDB: d4s1dc_, d4s1dd1, d4s1de_, d4s1df1, d4s1dh_, d4s1dl1, d4s1do_, d4s1dp1
automated match to d1h3pl2
complexed with 41m, so4

Details for d4s1dp2

PDB Entry: 4s1d (more details), 2.5 Å

PDB Description: structure of igg1 fab fragment in complex with biotincytidinamide

PDB Compounds: (P:) MAB M33 FAB FRAGMENT, light chain

SCOPe Domain Sequences for d4s1dp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4s1dp2 b.1.1.2 (P:108-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfn

SCOPe Domain Coordinates for d4s1dp2:

Click to download the PDB-style file with coordinates for d4s1dp2.
(The format of our PDB-style files is described here.)

Timeline for d4s1dp2: