Lineage for d4s1dd1 (4s1d D:1-107)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1767194Domain d4s1dd1: 4s1d D:1-107 [269893]
    Other proteins in same PDB: d4s1dd2, d4s1df2, d4s1dl2, d4s1dp2
    automated match to d1h3pl1
    complexed with 41m, so4

Details for d4s1dd1

PDB Entry: 4s1d (more details), 2.5 Å

PDB Description: structure of igg1 fab fragment in complex with biotincytidinamide
PDB Compounds: (D:) MAB M33 FAB FRAGMENT, light chain

SCOPe Domain Sequences for d4s1dd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4s1dd1 b.1.1.0 (D:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspaslsasvgetvtitcrasgnihnylswfqqkqgkspqllvysaktladgvps
rfsgsgsgtqyslkinslqpedfgtyycqhfwssiytfgggtkleik

SCOPe Domain Coordinates for d4s1dd1:

Click to download the PDB-style file with coordinates for d4s1dd1.
(The format of our PDB-style files is described here.)

Timeline for d4s1dd1: