Lineage for d1qqgb1 (1qqg B:11-114)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16243Fold b.55: PH domain-like [50728] (1 superfamily)
  4. 16244Superfamily b.55.1: PH domain-like [50729] (5 families) (S)
  5. 16302Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (4 proteins)
  6. 16303Protein Insulin receptor substrate 1, IRS-1 [50758] (1 species)
  7. 16304Species Human (Homo sapiens) [TaxId:9606] [50759] (2 PDB entries)
  8. 16307Domain d1qqgb1: 1qqg B:11-114 [26989]

Details for d1qqgb1

PDB Entry: 1qqg (more details), 2.3 Å

PDB Description: crystal structure of the ph-ptb targeting region of irs-1

SCOP Domain Sequences for d1qqgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qqgb1 b.55.1.2 (B:11-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens)}
sdvrkvgylrkpksmhkrffvlraaseaggparleyyenekkwrhkssapkrsiplescf
ninkradsknkhlvalytrdehfaiaadseaeqdswyqallqlh

SCOP Domain Coordinates for d1qqgb1:

Click to download the PDB-style file with coordinates for d1qqgb1.
(The format of our PDB-style files is described here.)

Timeline for d1qqgb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qqgb2