SCOP 1.55: Domain d1qqga2: 1qqg A:159-262

Lineage for d1qqga2 (1qqg A:159-262)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.55: PH domain-like [50728] (1 superfamily)

4. Superfamily b.55.1: PH domain-like [50729] (5 families)

5. Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (4 proteins)

6. Protein Insulin receptor substrate 1, IRS-1 [50758] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50759] (2 PDB entries)

8. Domain d1qqga2: 1qqg A:159-262 [26988]

Details for d1qqga2

PDB Entry: 1qqg, 2.3 Å

PDB Description: crystal structure of the ph-ptb targeting region of irs-1

SCOP Domain Sequences for d1qqga2:

Sequence; same for both SEQRES and ATOM records:

>d1qqga2 b.55.1.2 (A:159-262) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens)}
afkevwqvilkpkglgqtknligiyrlcltsktisfvklnseaaavvlqlmnirrcghse
nfffievgrsavtgpgefwmqvddsvvaqnmhetileamramsd

Timeline for d1qqga2:

• d1qqga2 appears in SCOP 1.57
  
• d1qqga2 appears in the current release, SCOPe 2.08