Class b: All beta proteins [48724] (180 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins) |
Protein Stress sensor protease DegS, C-terminal domain [110188] (1 species) |
Species Escherichia coli [TaxId:562] [110189] (6 PDB entries) Uniprot P31137 37-354 ! Uniprot P31137 |
Domain d4rr1b2: 4rr1 B:255-355 [269875] Other proteins in same PDB: d4rr1a1, d4rr1a3, d4rr1b1, d4rr1b3, d4rr1b4, d4rr1c1, d4rr1c2 automated match to d1sota1 complexed with ni, po4 |
PDB Entry: 4rr1 (more details), 2.3 Å
SCOPe Domain Sequences for d4rr1b2:
Sequence, based on SEQRES records: (download)
>d4rr1b2 b.36.1.4 (B:255-355) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} irgyigiggreiaplhaqgggidqlqgivvnevspdgpaanagiqvndliisvdnkpais aletmdqvaeirpgsvipvvvmrddkqltlqvtiqeypatn
>d4rr1b2 b.36.1.4 (B:255-355) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} irgyigigggivvnevspdgpaanagiqvndliisvdnkpaisaletmdqvaeirpgsvi pvvvmqltlqvtiqeypatn
Timeline for d4rr1b2: