SCOPe 2.05: Domain d1qqga1: 1qqg A:12-114

Lineage for d1qqga1 (1qqg A:12-114)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
   Pfam PF00640

6. Protein Insulin receptor substrate 1, IRS-1 [50758] (1 species)
   duplication: contains two domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [50759] (2 PDB entries)

8. Domain d1qqga1: 1qqg A:12-114 [26987]

Details for d1qqga1

PDB Entry: 1qqg, 2.3 Å

PDB Description: crystal structure of the ph-ptb targeting region of irs-1

PDB Compounds: (A:) insulin receptor substrate 1

SCOPe Domain Sequences for d1qqga1:

Sequence; same for both SEQRES and ATOM records:

>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]}
dvrkvgylrkpksmhkrffvlraaseaggparleyyenekkwrhkssapkrsiplescfn
inkradsknkhlvalytrdehfaiaadseaeqdswyqallqlh

Timeline for d1qqga1:

• d1qqga1 first appeared (with stable ids) in SCOP 1.55
  
• d1qqga1 appears in SCOPe 2.04
  
• d1qqga1 appears in SCOPe 2.06
  
• d1qqga1 appears in the current release, SCOPe 2.08