Lineage for d1qqga1 (1qqg A:12-114)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 378166Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 378167Superfamily b.55.1: PH domain-like [50729] (8 families) (S)
  5. 378247Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (8 proteins)
  6. 378270Protein Insulin receptor substrate 1, IRS-1 [50758] (1 species)
    duplication: contains two domains of this fold
  7. 378271Species Human (Homo sapiens) [TaxId:9606] [50759] (2 PDB entries)
  8. 378272Domain d1qqga1: 1qqg A:12-114 [26987]

Details for d1qqga1

PDB Entry: 1qqg (more details), 2.3 Å

PDB Description: crystal structure of the ph-ptb targeting region of irs-1

SCOP Domain Sequences for d1qqga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens)}
dvrkvgylrkpksmhkrffvlraaseaggparleyyenekkwrhkssapkrsiplescfn
inkradsknkhlvalytrdehfaiaadseaeqdswyqallqlh

SCOP Domain Coordinates for d1qqga1:

Click to download the PDB-style file with coordinates for d1qqga1.
(The format of our PDB-style files is described here.)

Timeline for d1qqga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qqga2