SCOPe 2.06: Domain d4rthb_: 4rth B:

Lineage for d4rthb_ (4rth B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.107: Mog1p/PsbP-like [55723] (1 superfamily)
   (beta-hairpin)-beta(3)-alpha-beta(4)-alpha; 3 layers: a/b/a; antiparallel beta-sheet of 7 strands; order: 1237654

4. Superfamily d.107.1: Mog1p/PsbP-like [55724] (4 families)

5. Family d.107.1.2: PsbP-like [111092] (2 proteins)
   Pfam PF01789

6. Protein automated matches [196539] (2 species)
   not a true protein

7. Species Maize (Zea mays) [TaxId:4577] [269867] (1 PDB entry)

8. Domain d4rthb_: 4rth B: [269868]
   automated match to d2vu4a_

Details for d4rthb_

PDB Entry: 4rth, 1.6 Å

PDB Description: the crystal structure of psbp from zea mays

PDB Compounds: (B:) Membrane-extrinsic protein of photosystem II PsbP

SCOPe Domain Sequences for d4rthb_:

Sequence, based on SEQRES records:

>d4rthb_ d.107.1.2 (B:) automated matches {Maize (Zea mays) [TaxId: 4577]}
ntdfisyvgdgfkllipskwnpskerefpgqvlryednfdansnvsviiqptskkaitey
gspeeflsqvdyllgkqayggktdseggfetdavatanvlesstpvvdgkqyysitvltr
tadgdeggkhqlitatvsdgklyickaqagdkrwfkgarkgvekaaasfsva

Sequence, based on observed residues (ATOM records):

>d4rthb_ d.107.1.2 (B:) automated matches {Maize (Zea mays) [TaxId: 4577]}
ntdfisyvgdgfkllipskwnpskerefpgqvlryednfdansnvsviiqptskkaitey
gspeeflsqvdyllgkqayggktdtdavatanvlesstpvvdgkqyysitvltrtadgde
ggkhqlitatvsdgklyickaqagdkrwfkgarkgvekaaasfsva

Timeline for d4rthb_:

• d4rthb_ first appeared in SCOPe 2.05
  
• d4rthb_ appears in SCOPe 2.07
  
• d4rthb_ appears in the current release, SCOPe 2.08