Lineage for d4rm4a_ (4rm4 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005543Species Bacillus subtilis [TaxId:135461] [269865] (1 PDB entry)
  8. 2005544Domain d4rm4a_: 4rm4 A: [269866]
    automated match to d2wi9b_
    complexed with hem

Details for d4rm4a_

PDB Entry: 4rm4 (more details), 1.77 Å

PDB Description: the crystal structure of the versatile cytochrome p450 enzyme cyp109b1 from bacillus subtilis
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d4rm4a_:

Sequence, based on SEQRES records: (download)

>d4rm4a_ a.104.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 135461]}
dayhpfpwyesmrkdapvsfdeenqvwsvflyddvkkvvgdkelfsscmpqqtssignsi
inmdppkhtkirsvvnkaftprvmkqwepriqeitdeliqkfqgrsefdlvhdfsyplpv
ivisellgvpsahmeqfkawsdllvstpkdkseeaekafleerdkceeelaaffagiiee
krnkpeqdiisilveaeetgeklsgeelipfctlllvagnetttnlisnamysiletpgv
yeelrshpelmpqaveealrfrapapvlrriakrdteigghlikegdmvlafvasanrde
akfdrphmfdirrhpnphiafghgihfclgaplarleanialtslisafphmecvsitpi
ensviyglksfrvkm

Sequence, based on observed residues (ATOM records): (download)

>d4rm4a_ a.104.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 135461]}
dayhpfpwyesmrkdapvsfdeenqvwsvflyddvkkvvgdkelfsscmgnsiinmdppk
htkirsvvnkaftprvmkqwepriqeitdeliqkfqgrsefdlvhdfsyplpvivisell
gvpsahmeqfkawsdllvstpkdkseeaekafleerdkceeelaaffagiieekrnkpeq
diisilvegeklsgeelipfctlllvagnetttnlisnamysiletpgvyeelrshpelm
pqaveealrfrapapvlrriakrdteigghlikegdmvlafvasanrdeakfdrphmfdi
rrhpnphiafghgihfclgaplarleanialtslisafphmecvsitpiensviyglksf
rvkm

SCOPe Domain Coordinates for d4rm4a_:

Click to download the PDB-style file with coordinates for d4rm4a_.
(The format of our PDB-style files is described here.)

Timeline for d4rm4a_: