Lineage for d4rkda_ (4rkd A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897848Species Psychrobacter sp. [TaxId:408968] [269853] (6 PDB entries)
  8. 2897860Domain d4rkda_: 4rkd A: [269860]
    automated match to d4wd2a_
    complexed with ket, mg, oaa, plp, pmp

Details for d4rkda_

PDB Entry: 4rkd (more details), 2.76 Å

PDB Description: psychrophilic aromatic amino acids aminotransferase from psychrobacter sp. b6 cocrystalized with aspartic acid
PDB Compounds: (A:) aromatic amino acid aminotransferase

SCOPe Domain Sequences for d4rkda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rkda_ c.67.1.0 (A:) automated matches {Psychrobacter sp. [TaxId: 408968]}
mferidyyagdpilglvekfaadnnpdkvnlgigiyydesgvmpvldcvkiaeqriadpi
sprpylpmaglpghrkgcqellfgkdapvlkdglvatiatiggsgalkvgaefihewfpq
skcyvsdptwgnhiaifegcdievgkypyydtatggikfdemiaffetlnkddvlllhpc
chnptgvdltreqwdtvlnviqerelipfmdiayqgfgedmdsdayairkavdmglplfv
snsfsknlslygervgglsvvcptvdetervfgqlnstvrriyssppshggrvvdivmnd
aalheqwvgevyamrdriksmrtklksvleakisgrnfdyltaqngmfsftgltpeqver
lqsefgiymisnsrmcvaglnssnidyvanamvdvlkd

SCOPe Domain Coordinates for d4rkda_:

Click to download the PDB-style file with coordinates for d4rkda_.
(The format of our PDB-style files is described here.)

Timeline for d4rkda_: