Lineage for d4ri4b_ (4ri4 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875762Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2875763Protein automated matches [190475] (10 species)
    not a true protein
  7. 2875775Species Human (Homo sapiens) [TaxId:9606] [187400] (140 PDB entries)
  8. 2875826Domain d4ri4b_: 4ri4 B: [269850]
    Other proteins in same PDB: d4ri4a2
    automated match to d2cfva_
    complexed with vo4; mutant

Details for d4ri4b_

PDB Entry: 4ri4 (more details), 1.6 Å

PDB Description: crystal structure of ptpn3 (ptph1) y676i mutant in complex with vanadate
PDB Compounds: (B:) Tyrosine-protein phosphatase non-receptor type 3

SCOPe Domain Sequences for d4ri4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ri4b_ c.45.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dtlegsmaqlkkglesgtvliqfeqlyrkkpglaitfaklpqnldknrikdvlpydttrv
llqgnedyinasyvnmeipaanlvnkyiatqgplphtcaqfwqvvwdqklslivmlttlt
ergrtkchqywpdppdvmnhggfhiqcqsedctiayvsremlvtntqtgeehtvthlqyv
awpdhgvpddssdflefvnyvrslrvdsepvlvhcsagigrtgvlvtmetamclternlp
iypldivrkmrdqrammvqtssqykfvceailrvyeeglvq

SCOPe Domain Coordinates for d4ri4b_:

Click to download the PDB-style file with coordinates for d4ri4b_.
(The format of our PDB-style files is described here.)

Timeline for d4ri4b_: