Lineage for d1x11a_ (1x11 A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672997Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 672998Superfamily b.55.1: PH domain-like [50729] (12 families) (S)
  5. 673212Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (12 proteins)
    Pfam PF00640
  6. 673270Protein X11 [50756] (1 species)
  7. 673271Species Human (Homo sapiens) [TaxId:9606] [50757] (2 PDB entries)
  8. 673274Domain d1x11a_: 1x11 A: [26985]

Details for d1x11a_

PDB Entry: 1x11 (more details), 2.4 Å

PDB Description: x11 ptb domain
PDB Compounds: (A:) x11

SCOP Domain Sequences for d1x11a_:

Sequence, based on SEQRES records: (download)

>d1x11a_ b.55.1.2 (A:) X11 {Human (Homo sapiens) [TaxId: 9606]}
medlidgiifaanylgstqllsdktpsknvrmmqaqeavsrikmaqklaksrkkapeges
qpmtevdlfiltqrikvlnadtqetmmdhplrtisyiadignivvlmarrriprsnsqen
veashpsqdgkrqykmichvfesedaqliaqsigqafsvayqeflrangi

Sequence, based on observed residues (ATOM records): (download)

>d1x11a_ b.55.1.2 (A:) X11 {Human (Homo sapiens) [TaxId: 9606]}
medlidgiifaanylgstqllsdktpsknvrmmqaqeavsrikmaqmtevdlfiltqrik
vlnadtqetmmdhplrtisyiadignivvlmarrgkrqykmichvfesedaqliaqsigq
afsvayqeflrangi

SCOP Domain Coordinates for d1x11a_:

Click to download the PDB-style file with coordinates for d1x11a_.
(The format of our PDB-style files is described here.)

Timeline for d1x11a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1x11b_