Lineage for d4rbva_ (4rbv A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2198653Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 2198733Family d.58.56.0: automated matches [195116] (1 protein)
    not a true family
  6. 2198734Protein automated matches [195117] (12 species)
    not a true protein
  7. 2198824Species Salmonella enterica [TaxId:99287] [257522] (6 PDB entries)
  8. 2198862Domain d4rbva_: 4rbv A: [269835]
    Other proteins in same PDB: d4rbvb2
    automated match to d4ppda_
    complexed with so4; mutant

Details for d4rbva_

PDB Entry: 4rbv (more details), 3.1 Å

PDB Description: pdua k26a s40gsg mutant, from salmonella enterica serovar typhimurium lt2
PDB Compounds: (A:) Propanediol utilization protein pduA

SCOPe Domain Sequences for d4rbva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rbva_ d.58.56.0 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
qealgmvetkgltaaieaadamvasanvmlvgyekiggsgglvtvivrgdvgavkaatda
gaaaarnvgevkavhviprphtdvekilpkgis

SCOPe Domain Coordinates for d4rbva_:

Click to download the PDB-style file with coordinates for d4rbva_.
(The format of our PDB-style files is described here.)

Timeline for d4rbva_: