Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.56: CcmK-like [143414] (2 families) contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape |
Family d.58.56.0: automated matches [195116] (1 protein) not a true family |
Protein automated matches [195117] (12 species) not a true protein |
Species Salmonella enterica [TaxId:99287] [257522] (6 PDB entries) |
Domain d4rbuf_: 4rbu F: [269832] automated match to d4ppda_ complexed with so4; mutant |
PDB Entry: 4rbu (more details), 2.79 Å
SCOPe Domain Sequences for d4rbuf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rbuf_ d.58.56.0 (F:) automated matches {Salmonella enterica [TaxId: 99287]} ealgmvetkgltaaieaadamvasanvmlvgyekigqglvtvivrgdvgavkaatdagaa aarnvgevkavhviprphtdvekilpkgi
Timeline for d4rbuf_: