Lineage for d4rbuf_ (4rbu F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562704Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 2562793Family d.58.56.0: automated matches [195116] (1 protein)
    not a true family
  6. 2562794Protein automated matches [195117] (12 species)
    not a true protein
  7. 2562892Species Salmonella enterica [TaxId:99287] [257522] (6 PDB entries)
  8. 2562926Domain d4rbuf_: 4rbu F: [269832]
    automated match to d4ppda_
    complexed with so4; mutant

Details for d4rbuf_

PDB Entry: 4rbu (more details), 2.79 Å

PDB Description: pdua k26a s40q mutant, from salmonella enterica serovar typhimurium lt2
PDB Compounds: (F:) Propanediol utilization protein pduA

SCOPe Domain Sequences for d4rbuf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rbuf_ d.58.56.0 (F:) automated matches {Salmonella enterica [TaxId: 99287]}
ealgmvetkgltaaieaadamvasanvmlvgyekigqglvtvivrgdvgavkaatdagaa
aarnvgevkavhviprphtdvekilpkgi

SCOPe Domain Coordinates for d4rbuf_:

Click to download the PDB-style file with coordinates for d4rbuf_.
(The format of our PDB-style files is described here.)

Timeline for d4rbuf_: