Lineage for d1aqca_ (1aqc A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803365Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 2803429Protein X11 [50756] (1 species)
  7. 2803430Species Human (Homo sapiens) [TaxId:9606] [50757] (2 PDB entries)
  8. 2803431Domain d1aqca_: 1aqc A: [26983]
    has additional insertions and/or extensions that are not grouped together

Details for d1aqca_

PDB Entry: 1aqc (more details), 2.3 Å

PDB Description: x11 ptb domain-10mer peptide complex
PDB Compounds: (A:) x11

SCOPe Domain Sequences for d1aqca_:

Sequence, based on SEQRES records: (download)

>d1aqca_ b.55.1.2 (A:) X11 {Human (Homo sapiens) [TaxId: 9606]}
medlidgiifaanylgstqllsdktpsknvrmmqaqeavsrikmaqklaksrkkapeges
qpmtevdlfiltqrikvlnadtqetmmdhplrtisyiadignivvlmarrriprsnsqen
veashpsqdgkrqykmichvfesedaqliaqsigqafsvayqeflr

Sequence, based on observed residues (ATOM records): (download)

>d1aqca_ b.55.1.2 (A:) X11 {Human (Homo sapiens) [TaxId: 9606]}
medlidgiifaanylgstqllsdktpsknvrmmqaqeavsrikmaqklmtevdlfiltqr
ikvlnadtqetmmdhplrtisyiadignivvlmarrrykmichvfesedaqliaqsigqa
fsvayqeflr

SCOPe Domain Coordinates for d1aqca_:

Click to download the PDB-style file with coordinates for d1aqca_.
(The format of our PDB-style files is described here.)

Timeline for d1aqca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aqcb_