Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
Protein Galectin-3 CRD [49940] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49941] (83 PDB entries) |
Domain d4r9ba_: 4r9b A: [269822] automated match to d4lbma_ complexed with lat |
PDB Entry: 4r9b (more details), 1.2 Å
SCOPe Domain Sequences for d4r9ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r9ba_ b.29.1.3 (A:) Galectin-3 CRD {Human (Homo sapiens) [TaxId: 9606]} plivpynlplpggvvprmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrviv cntkldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneis klgisgdidltsasytmi
Timeline for d4r9ba_: