Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
Protein automated matches [190753] (16 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [269820] (2 PDB entries) |
Domain d4r25a1: 4r25 A:10-121 [269821] Other proteins in same PDB: d4r25a2 automated match to d3lf0a_ complexed with zn |
PDB Entry: 4r25 (more details), 2.52 Å
SCOPe Domain Sequences for d4r25a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r25a1 d.58.5.0 (A:10-121) automated matches {Bacillus subtilis [TaxId: 224308]} mfkveivtrpanfeklkqelgkigvtsltfsnvhgcglqkahtelyrgvkiesnvyerlk ieivvskvpvdqvtetakrvlktgspgdgkifvyeisntinirtgeegpeal
Timeline for d4r25a1: