SCOPe 2.08: Domain d4r25a1: 4r25 A:10-121

Lineage for d4r25a1 (4r25 A:10-121)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.0: automated matches [191474] (1 protein)
   not a true family

6. Protein automated matches [190753] (21 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [269820] (2 PDB entries)

8. Domain d4r25a1: 4r25 A:10-121 [269821]
   Other proteins in same PDB: d4r25a2
   automated match to d3lf0a_
   complexed with zn

Details for d4r25a1

PDB Entry: 4r25, 2.52 Å

PDB Description: structure of b. subtilis glnk

PDB Compounds: (A:) Nitrogen regulatory PII-like protein

SCOPe Domain Sequences for d4r25a1:

Sequence; same for both SEQRES and ATOM records:

>d4r25a1 d.58.5.0 (A:10-121) automated matches {Bacillus subtilis [TaxId: 224308]}
mfkveivtrpanfeklkqelgkigvtsltfsnvhgcglqkahtelyrgvkiesnvyerlk
ieivvskvpvdqvtetakrvlktgspgdgkifvyeisntinirtgeegpeal

Timeline for d4r25a1:

• d4r25a1 first appeared in SCOPe 2.05, called d4r25a_
  
• d4r25a1 appears in SCOPe 2.07