Lineage for d4qcia2 (4qci A:107-207)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757274Domain d4qcia2: 4qci A:107-207 [269817]
    Other proteins in same PDB: d4qcib_, d4qcic_, d4qcid_, d4qcih_
    automated match to d1nfde2

Details for d4qcia2

PDB Entry: 4qci (more details), 2.3 Å

PDB Description: pdgf-b blocking antibody bound to pdgf-bb
PDB Compounds: (A:) anti-PDGF-BB antibody - Light Chain

SCOPe Domain Sequences for d4qcia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qcia2 b.1.1.0 (A:107-207) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkstptltvfppsseelkenkatlvclisnfspsgvtvawkangtpitqgvdtsnptkeg
nkfmassflhltsdqwrshnsftcqvthegdtvekslspae

SCOPe Domain Coordinates for d4qcia2:

Click to download the PDB-style file with coordinates for d4qcia2.
(The format of our PDB-style files is described here.)

Timeline for d4qcia2: