SCOPe 2.08: Domain d4qcia1: 4qci A:2-106

Lineage for d4qcia1 (4qci A:2-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4qcia1: 4qci A:2-106 [269816]
   Other proteins in same PDB: d4qcib_, d4qcic_, d4qcid_, d4qcih_
   automated match to d1nfde1

Details for d4qcia1

PDB Entry: 4qci, 2.3 Å

PDB Description: pdgf-b blocking antibody bound to pdgf-bb

PDB Compounds: (A:) anti-PDGF-BB antibody - Light Chain

SCOPe Domain Sequences for d4qcia1:

Sequence; same for both SEQRES and ATOM records:

>d4qcia1 b.1.1.0 (A:2-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yeltqppsvsvapgqtariscsgdslgsyfvhwyqqkpgqapvlviyddsnrpsgiperf
sgsnsgntatltisgtqaedeadyycsafthnsdvfgggtkltvl

Timeline for d4qcia1:

• d4qcia1 first appeared in SCOPe 2.05
  
• d4qcia1 appears in SCOPe 2.07