Lineage for d4qkha1 (4qkh A:72-191)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002332Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)
  8. 3002470Domain d4qkha1: 4qkh A:72-191 [269812]
    Other proteins in same PDB: d4qkha2, d4qkha3, d4qkhb2
    automated match to d3rs1a_
    complexed with nag

Details for d4qkha1

PDB Entry: 4qkh (more details), 1.8 Å

PDB Description: dimeric form of human llt1, a ligand for nkr-p1
PDB Compounds: (A:) C-type lectin domain family 2 member D

SCOPe Domain Sequences for d4qkha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qkha1 d.169.1.0 (A:72-191) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qaacpeswigfqrkcfyfsddtknwtssqrfcdsqdadlaqvesfqelnfllrykgpsdh
wiglsreqgqpwkwingtewtrqfpilgagecaylndkgassarcyterkwicsksdihv

SCOPe Domain Coordinates for d4qkha1:

Click to download the PDB-style file with coordinates for d4qkha1.
(The format of our PDB-style files is described here.)

Timeline for d4qkha1: