Lineage for d4qkja_ (4qkj A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2608201Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2608202Protein automated matches [190159] (20 species)
    not a true protein
  7. 2608257Species Human (Homo sapiens) [TaxId:9606] [186882] (106 PDB entries)
  8. 2608552Domain d4qkja_: 4qkj A: [269808]
    automated match to d3rs1a_
    complexed with nag

Details for d4qkja_

PDB Entry: 4qkj (more details), 2.75 Å

PDB Description: glycosylated form of human llt1, a ligand for nkr-p1, in this structure forming hexamers
PDB Compounds: (A:) C-type lectin domain family 2 member D

SCOPe Domain Sequences for d4qkja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qkja_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
acpeswigfqrkcfyfsddtknwtssqrfcdsqdadlaqvesfqelnfllrykgpsdhwi
glsreqgqpwkwingtewtrqfpilgagecaylndkgassarcyterkwicsksd

SCOPe Domain Coordinates for d4qkja_:

Click to download the PDB-style file with coordinates for d4qkja_.
(The format of our PDB-style files is described here.)

Timeline for d4qkja_: