Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
Protein Mitotic rotamase PIN1, domain 2 [54547] (2 species) Domain 1 is a WW-domain |
Species Human (Homo sapiens) [TaxId:9606] [54548] (52 PDB entries) |
Domain d4qiba2: 4qib A:51-163 [269805] Other proteins in same PDB: d4qiba1 automated match to d1pina2 complexed with pe4, so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 4qib (more details), 1.86 Å
SCOPe Domain Sequences for d4qiba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qiba2 d.26.1.1 (A:51-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]} eparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqf sdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte
Timeline for d4qiba2: