Lineage for d1fhwb_ (1fhw B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672997Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 672998Superfamily b.55.1: PH domain-like [50729] (12 families) (S)
  5. 672999Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (43 proteins)
    Pfam PF00169
  6. 673099Protein Grp1 [50751] (1 species)
    ARF1 Guanine nucleotide exchange factor and integrin binding protein homolog
  7. 673100Species Mouse (Mus musculus) [TaxId:10090] [50752] (4 PDB entries)
  8. 673103Domain d1fhwb_: 1fhw B: [26978]
    complexed with i5p, so4

Details for d1fhwb_

PDB Entry: 1fhw (more details), 1.9 Å

PDB Description: Structure of the pleckstrin homology domain from GRP1 in complex with inositol(1,3,4,5,6)pentakisphosphate
PDB Compounds: (B:) guanine nucleotide exchange factor and integrin binding protein homolog grp1

SCOP Domain Sequences for d1fhwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhwb_ b.55.1.1 (B:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]}
dregwllklggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsirevedprkpn
cfelynpshkgqvikackteadgrvvegnhvvyrisapspeekeewmksikasisrdpfy
dmlatr

SCOP Domain Coordinates for d1fhwb_:

Click to download the PDB-style file with coordinates for d1fhwb_.
(The format of our PDB-style files is described here.)

Timeline for d1fhwb_: