SCOPe 2.05: Domain d4pgjc_: 4pgj C:

Lineage for d4pgjc_ (4pgj C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries)

8. Domain d4pgjc_: 4pgj C: [269761]
   Other proteins in same PDB: d4pgjb_, d4pgjd_
   automated match to d1ohqa_

Details for d4pgjc_

PDB Entry: 4pgj, 2.6 Å

PDB Description: human heavy-chain domain antibody in complex with hen egg-white lysozyme

PDB Compounds: (C:) Human heavy chain domain antibody

SCOPe Domain Sequences for d4pgjc_:

Sequence, based on SEQRES records:

>d4pgjc_ b.1.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qllesggglvqpggslrlscaasgfrfdaedmgwvrqapgkglewvssiygpsgstyyad
svkgrftisrdnskntlylqmnslraedtavyycakytsppqnhgfdywgqgtlvtvs

Sequence, based on observed residues (ATOM records):

>d4pgjc_ b.1.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qllesggglvqpggslrlscaasgfrfedmgwvrqkglewvssiygpsgstyyadsvkgr
ftisrntlylqmnslraedtavyycakytsppqnhgfdywgqgtlvtvs

Timeline for d4pgjc_:

• d4pgjc_ is new in SCOPe 2.05-stable
  
• d4pgjc_ appears in SCOPe 2.06
  
• d4pgjc_ appears in the current release, SCOPe 2.08