Lineage for d4prwa_ (4prw A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2831084Protein Xylanase [51488] (6 species)
  7. 2831100Species Bacillus stearothermophilus, Xt6 [TaxId:1422] [69386] (8 PDB entries)
    Uniprot P40943
  8. 2831104Domain d4prwa_: 4prw A: [269755]
    automated match to d1hiza_
    complexed with cl, so4, zn

Details for d4prwa_

PDB Entry: 4prw (more details), 1.8 Å

PDB Description: xylanase t6 (xt6) from geobacillus stearothermophilus in complex with xylohexaose
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d4prwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4prwa_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]}
kphisalnapqldqrykneftigaavepyqlqnekdvqmlkrhfnsivaenvmkpisiqp
eegkfnfeqadrivkfakangmdirfhtlvwhsqvpqwffldkegkpmvnetdpvkreqn
kqlllkrlethiktiverykddikywdvvnqvvgddgklrnspwyqiagidyikvafqaa
rkyggdniklymndyntevepkrtalynlvkqlkeegvpidgighqshiqigwpseaeie
ktinmfaalgldnqiteldvsmygwpprayptydaipkqkfldqaarydrlfklyeklsd
kisnvtfwgiadnhtwldsradvyydangnvvvdpnapyakvekgkgkdapfvfgpdykv
kpaywaiidhk

SCOPe Domain Coordinates for d4prwa_:

Click to download the PDB-style file with coordinates for d4prwa_.
(The format of our PDB-style files is described here.)

Timeline for d4prwa_: