Lineage for d4pcvb_ (4pcv B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1831140Species Escherichia coli [TaxId:1116044] [269747] (1 PDB entry)
  8. 1831142Domain d4pcvb_: 4pcv B: [269750]
    automated match to d3vzpb_
    complexed with 1pe, pge

Details for d4pcvb_

PDB Entry: 4pcv (more details), 2.05 Å

PDB Description: the structure of bdca (yjgi) from e. coli
PDB Compounds: (B:) BdcA (YjgI)

SCOPe Domain Sequences for d4pcvb_:

Sequence, based on SEQRES records: (download)

>d4pcvb_ c.2.1.0 (B:) automated matches {Escherichia coli [TaxId: 1116044]}
hmgaftgktvlilggsrgigaaivrrfvtdganvrftyagskdaakrlaqetgatavftd
sadrdavidvvrksgaldilvvnagigvfgealelnaddidrlfkinihapyhasveaar
qmpeggriliigsvngdrmpvagmaayaasksalqgmarglardfgprgitinvvqpgpi
dtdanpangpmrdmlhslmaikrhgqpeevagmvawlagpeasfvtgamhti

Sequence, based on observed residues (ATOM records): (download)

>d4pcvb_ c.2.1.0 (B:) automated matches {Escherichia coli [TaxId: 1116044]}
hmgaftgktvlilggsrgigaaivrrfvtdganvrftyagskdaakrlaqetgatavftd
sadrdavidvvrksgaldilvvnagalelnaddidrlfkinihapyhasveaarqmpegg
riliigsvngmaayaasksalqgmarglardfgprgitinvvqpeevagmvawlagpeas
fvtgamhti

SCOPe Domain Coordinates for d4pcvb_:

Click to download the PDB-style file with coordinates for d4pcvb_.
(The format of our PDB-style files is described here.)

Timeline for d4pcvb_: