Lineage for d4p3na1 (4p3n A:322-611)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574231Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2574232Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2574631Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2574632Protein automated matches [226887] (24 species)
    not a true protein
  7. 2574692Species Human (Homo sapiens) [TaxId:9606] [225403] (12 PDB entries)
  8. 2574713Domain d4p3na1: 4p3n A:322-611 [269745]
    Other proteins in same PDB: d4p3na2, d4p3nb2, d4p3nc2, d4p3nd2
    automated match to d4hwra1
    protein/RNA complex; complexed with 2cr, zn

Details for d4p3na1

PDB Entry: 4p3n (more details), 2.6 Å

PDB Description: structural basis for full-spectrum inhibition of threonyl-trna synthetase by borrelidin 1
PDB Compounds: (A:) Threonine--tRNA ligase, cytoplasmic

SCOPe Domain Sequences for d4p3na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p3na1 d.104.1.0 (A:322-611) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhrkigrdqelyffhelspgscfflpkgayiynaliefirseyrkrgfqevvtpnifnsr
lwmtsghwqhysenmfsfevekelfalkpmncpghclmfdhrprswrelplrladfgvlh
rnelsgaltgltrvrrfqqddahifcameqiedeikgcldflrtvysvfgfsfklnlstr
pekflgdievwdqaekqlenslnefgekwelnsgdgafygpkidiqikdaigryhqcati
qldfqlpirfnltyvshdgddkkrpvivhrailgsvermiailtenyggk

SCOPe Domain Coordinates for d4p3na1:

Click to download the PDB-style file with coordinates for d4p3na1.
(The format of our PDB-style files is described here.)

Timeline for d4p3na1: