SCOPe 2.08: Domain d4p3na1: 4p3n A:322-611

Lineage for d4p3na1 (4p3n A:322-611)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.0: automated matches [227172] (1 protein)
   not a true family

6. Protein automated matches [226887] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225403] (12 PDB entries)

8. Domain d4p3na1: 4p3n A:322-611 [269745]
   Other proteins in same PDB: d4p3na2, d4p3nb2, d4p3nc2, d4p3nd2
   automated match to d4hwra1
   protein/RNA complex; complexed with 2cr, zn

Details for d4p3na1

PDB Entry: 4p3n, 2.6 Å

PDB Description: structural basis for full-spectrum inhibition of threonyl-trna synthetase by borrelidin 1

PDB Compounds: (A:) Threonine--tRNA ligase, cytoplasmic

SCOPe Domain Sequences for d4p3na1:

Sequence; same for both SEQRES and ATOM records:

>d4p3na1 d.104.1.0 (A:322-611) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhrkigrdqelyffhelspgscfflpkgayiynaliefirseyrkrgfqevvtpnifnsr
lwmtsghwqhysenmfsfevekelfalkpmncpghclmfdhrprswrelplrladfgvlh
rnelsgaltgltrvrrfqqddahifcameqiedeikgcldflrtvysvfgfsfklnlstr
pekflgdievwdqaekqlenslnefgekwelnsgdgafygpkidiqikdaigryhqcati
qldfqlpirfnltyvshdgddkkrpvivhrailgsvermiailtenyggk

Timeline for d4p3na1:

• d4p3na1 first appeared in SCOPe 2.05
  
• d4p3na1 appears in SCOPe 2.07