Lineage for d4p3nc2 (4p3n C:612-723)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489766Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2489767Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2489886Family c.51.1.0: automated matches [227929] (1 protein)
    not a true family
  6. 2489887Protein automated matches [227930] (6 species)
    not a true protein
  7. 2489907Species Human (Homo sapiens) [TaxId:9606] [227931] (3 PDB entries)
  8. 2489912Domain d4p3nc2: 4p3n C:612-723 [269742]
    Other proteins in same PDB: d4p3na1, d4p3nb1, d4p3nc1, d4p3nd1
    automated match to d4hwra2
    protein/RNA complex; complexed with 2cr, zn

Details for d4p3nc2

PDB Entry: 4p3n (more details), 2.6 Å

PDB Description: structural basis for full-spectrum inhibition of threonyl-trna synthetase by borrelidin 1
PDB Compounds: (C:) Threonine--tRNA ligase, cytoplasmic

SCOPe Domain Sequences for d4p3nc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p3nc2 c.51.1.0 (C:612-723) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wpfwlsprqvmvvpvgptcdeyaqkvrqqfhdakfmadidldpgctlnkkirnaqlaqyn
filvvgekekisgtvnirtrdnkvhgertisetierlqqlkefrskqaeeef

SCOPe Domain Coordinates for d4p3nc2:

Click to download the PDB-style file with coordinates for d4p3nc2.
(The format of our PDB-style files is described here.)

Timeline for d4p3nc2: