Lineage for d1faoa_ (1fao A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061576Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2061577Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2061578Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 protein domains)
    Pfam PF00169
  6. 2061639Protein Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH [50749] (1 species)
  7. 2061640Species Human (Homo sapiens) [TaxId:9606] [50750] (2 PDB entries)
  8. 2061641Domain d1faoa_: 1fao A: [26974]
    complexed with 4ip

Details for d1faoa_

PDB Entry: 1fao (more details), 1.8 Å

PDB Description: structure of the pleckstrin homology domain from dapp1/phish in complex with inositol 1,3,4,5-tetrakisphosphate
PDB Compounds: (A:) dual adaptor of phosphotyrosine and 3-phosphoinositides

SCOPe Domain Sequences for d1faoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]}
pslgtkegyltkqgglvktwktrwftlhrnelkyfkdqmspepirildltecsavqfdys
qervncfclvfpfrtfylcaktgveadewikilrwklsqi

SCOPe Domain Coordinates for d1faoa_:

Click to download the PDB-style file with coordinates for d1faoa_.
(The format of our PDB-style files is described here.)

Timeline for d1faoa_: