| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
| Family d.104.1.0: automated matches [227172] (1 protein) not a true family |
| Protein automated matches [226887] (9 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225403] (8 PDB entries) |
| Domain d4p3nb1: 4p3n B:322-611 [269739] Other proteins in same PDB: d4p3na2, d4p3nb2, d4p3nc2, d4p3nd2 automated match to d4hwra1 protein/RNA complex; complexed with 2cr, zn |
PDB Entry: 4p3n (more details), 2.6 Å
SCOPe Domain Sequences for d4p3nb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p3nb1 d.104.1.0 (B:322-611) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhrkigrdqelyffhelspgscfflpkgayiynaliefirseyrkrgfqevvtpnifnsr
lwmtsghwqhysenmfsfevekelfalkpmncpghclmfdhrprswrelplrladfgvlh
rnelsgaltgltrvrrfqqddahifcameqiedeikgcldflrtvysvfgfsfklnlstr
pekflgdievwdqaekqlenslnefgekwelnsgdgafygpkidiqikdaigryhqcati
qldfqlpirfnltyvshdgddkkrpvivhrailgsvermiailtenyggk
Timeline for d4p3nb1: