![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
![]() | Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) ![]() |
![]() | Family c.51.1.0: automated matches [227929] (1 protein) not a true family |
![]() | Protein automated matches [227930] (3 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [227937] (6 PDB entries) |
![]() | Domain d4p3oa2: 4p3o A:533-642 [269732] Other proteins in same PDB: d4p3oa1, d4p3ob1 automated match to d4hwra2 complexed with 2cr, gol, zn |
PDB Entry: 4p3o (more details), 2.51 Å
SCOPe Domain Sequences for d4p3oa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p3oa2 c.51.1.0 (A:533-642) automated matches {Escherichia coli K-12 [TaxId: 83333]} fptwlapvqvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpy mlvcgdkevesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee
Timeline for d4p3oa2: