Lineage for d4p3oa1 (4p3o A:242-532)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208545Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2208546Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2208547Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2208773Protein automated matches [193659] (6 species)
    not a true protein
  7. 2208788Species Escherichia coli K-12 [TaxId:83333] [227935] (6 PDB entries)
  8. 2208799Domain d4p3oa1: 4p3o A:242-532 [269731]
    Other proteins in same PDB: d4p3oa2, d4p3ob2
    automated match to d4hwra1
    complexed with 2cr, gol, zn

Details for d4p3oa1

PDB Entry: 4p3o (more details), 2.51 Å

PDB Description: structural basis for full-spectrum inhibition of threonyl-trna synthetase by borrelidin 2
PDB Compounds: (A:) Threonine--tRNA ligase

SCOPe Domain Sequences for d4p3oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p3oa1 d.104.1.1 (A:242-532) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagf

SCOPe Domain Coordinates for d4p3oa1:

Click to download the PDB-style file with coordinates for d4p3oa1.
(The format of our PDB-style files is described here.)

Timeline for d4p3oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4p3oa2