Lineage for d1baka_ (1bak A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061576Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2061577Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2061578Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 protein domains)
    Pfam PF00169
  6. 2061658Protein G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) [50747] (2 species)
  7. 2061669Species Human (Homo sapiens) [TaxId:9606] [50748] (1 PDB entry)
  8. 2061670Domain d1baka_: 1bak A: [26973]

Details for d1baka_

PDB Entry: 1bak (more details)

PDB Description: signal transduction pleckstrin homology domain of g-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1), c-terminal extended, nmr, 20 structures
PDB Compounds: (A:) g-protein coupled receptor kinase 2

SCOPe Domain Sequences for d1baka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1baka_ b.55.1.1 (A:) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Human (Homo sapiens) [TaxId: 9606]}
gshmgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsvee
tqikerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkprs

SCOPe Domain Coordinates for d1baka_:

Click to download the PDB-style file with coordinates for d1baka_.
(The format of our PDB-style files is described here.)

Timeline for d1baka_: