![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.55: PH domain-like [50728] (1 superfamily) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (8 families) ![]() |
![]() | Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (15 proteins) |
![]() | Protein GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) [50745] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [50746] (1 PDB entry) |
![]() | Domain d1foeg2: 1foe G:1240-1401 [26972] Other proteins in same PDB: d1foea1, d1foeb_, d1foec1, d1foed_, d1foee1, d1foef_, d1foeg1, d1foeh_ complexed with so4; mutant |
PDB Entry: 1foe (more details), 2.8 Å
SCOP Domain Sequences for d1foeg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1foeg2 b.55.1.1 (G:1240-1401) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus)} efgavfdqliaeqtgekkevadlsmgdlllhtsviwlnppaslgkwkkepelaafvfkta vvlvykdgskqkkklvgshrlsiyeewdpfrfrhmiptealqvralpsadaeanavceiv hvksesegrpervfhlccsspesrkdflksvhsilrdkhrrq
Timeline for d1foeg2: