SCOPe 2.08: Domain d4oxfa1: 4oxf A:1-133

Lineage for d4oxfa1 (4oxf A:1-133)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Eosinophil cationic protein (ECP), ribonuclease 3 [54090] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54091] (11 PDB entries)

8. Domain d4oxfa1: 4oxf A:1-133 [269717]
   Other proteins in same PDB: d4oxfa2
   automated match to d1h1ha_
   complexed with cit, fe

Details for d4oxfa1

PDB Entry: 4oxf, 1.5 Å

PDB Description: structure of ecp in complex with citrate ions at 1.50 angstroms

PDB Compounds: (A:) eosinophil cationic protein

SCOPe Domain Sequences for d4oxfa1:

Sequence; same for both SEQRES and ATOM records:

>d4oxfa1 d.5.1.1 (A:1-133) Eosinophil cationic protein (ECP), ribonuclease 3 {Human (Homo sapiens) [TaxId: 9606]}
rppqftraqwfaiqhislnpprctiamrainnyrwrcknqntflrttfanvvnvcgnqsi
rcphnrtlnnchrsrfrvpllhcdlinpgaqnisncryadrpgrrfyvvacdnrdprdsp
rypvvpvhldtti

Timeline for d4oxfa1:

• d4oxfa1 first appeared in SCOPe 2.05, called d4oxfa_
  
• d4oxfa1 appears in SCOPe 2.07