Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
Protein Eosinophil cationic protein (ECP), ribonuclease 3 [54090] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54091] (11 PDB entries) |
Domain d4oxbb_: 4oxb B: [269716] automated match to d1h1ha_ complexed with so4 |
PDB Entry: 4oxb (more details), 1.5 Å
SCOPe Domain Sequences for d4oxbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oxbb_ d.5.1.1 (B:) Eosinophil cationic protein (ECP), ribonuclease 3 {Human (Homo sapiens) [TaxId: 9606]} rppqftraqwfaiqhislnpprctiamrainnyrwrcknqntflrttfanvvnvcgnqsi rcphnrtlnnchrsrfrvpllhcdlinpgaqnisncryadrpgrrfyvvacdnrdprdsp rypvvpvhldtti
Timeline for d4oxbb_: