![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
![]() | Superfamily d.5.1: RNase A-like [54076] (2 families) ![]() can be classified as disulfide-rich |
![]() | Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
![]() | Protein Eosinophil cationic protein (ECP), ribonuclease 3 [54090] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54091] (11 PDB entries) |
![]() | Domain d4oxfb_: 4oxf B: [269714] Other proteins in same PDB: d4oxfa2 automated match to d1h1ha_ complexed with cit, fe |
PDB Entry: 4oxf (more details), 1.5 Å
SCOPe Domain Sequences for d4oxfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oxfb_ d.5.1.1 (B:) Eosinophil cationic protein (ECP), ribonuclease 3 {Human (Homo sapiens) [TaxId: 9606]} rppqftraqwfaiqhislnpprctiamrainnyrwrcknqntflrttfanvvnvcgnqsi rcphnrtlnnchrsrfrvpllhcdlinpgaqnisncryadrpgrrfyvvacdnrdprdsp rypvvpvhldtti
Timeline for d4oxfb_: