Lineage for d4ogkf_ (4ogk F:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2140829Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2140830Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2141244Protein Uridine phosphorylase [53176] (6 species)
  7. 2141358Species Salmonella typhimurium [TaxId:90371] [117656] (24 PDB entries)
    Uniprot P0A1F6
  8. 2141479Domain d4ogkf_: 4ogk F: [269705]
    automated match to d1ryza_
    complexed with edo, ipa, k, peg, pg4, thm

Details for d4ogkf_

PDB Entry: 4ogk (more details), 2.4 Å

PDB Description: x-ray structure of the uridine phosphorylase from salmonella typhimurium in complex with thymidine at 2.40 a resolution
PDB Compounds: (F:) Uridine phosphorylase

SCOPe Domain Sequences for d4ogkf_:

Sequence, based on SEQRES records: (download)

>d4ogkf_ c.56.2.1 (F:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 90371]}
sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

Sequence, based on observed residues (ATOM records): (download)

>d4ogkf_ c.56.2.1 (F:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 90371]}
sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmhavkivvea
arrll

SCOPe Domain Coordinates for d4ogkf_:

Click to download the PDB-style file with coordinates for d4ogkf_.
(The format of our PDB-style files is described here.)

Timeline for d4ogkf_: