Lineage for d1foec2 (1foe C:1240-1401)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2070982Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2071079Protein GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) [50745] (1 species)
  7. 2071080Species Mouse (Mus musculus) [TaxId:10090] [50746] (1 PDB entry)
  8. 2071082Domain d1foec2: 1foe C:1240-1401 [26970]
    Other proteins in same PDB: d1foea1, d1foeb_, d1foec1, d1foed_, d1foee1, d1foef_, d1foeg1, d1foeh_
    complexed with so4

Details for d1foec2

PDB Entry: 1foe (more details), 2.8 Å

PDB Description: crystal structure of rac1 in complex with the guanine nucleotide exchange region of tiam1
PDB Compounds: (C:) t-lymphoma invasion and metastasis inducing protein 1

SCOPe Domain Sequences for d1foec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1foec2 b.55.1.1 (C:1240-1401) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]}
efgavfdqliaeqtgekkevadlsmgdlllhtsviwlnppaslgkwkkepelaafvfkta
vvlvykdgskqkkklvgshrlsiyeewdpfrfrhmiptealqvralpsadaeanavceiv
hvksesegrpervfhlccsspesrkdflksvhsilrdkhrrq

SCOPe Domain Coordinates for d1foec2:

Click to download the PDB-style file with coordinates for d1foec2.
(The format of our PDB-style files is described here.)

Timeline for d1foec2: