SCOPe 2.06: Domain d4of4b_: 4of4 B:

Lineage for d4of4b_ (4of4 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein Uridine phosphorylase [53176] (6 species)

7. Species Yersinia pseudotuberculosis [TaxId:633] [229814] (2 PDB entries)

8. Domain d4of4b_: 4of4 B: [269698]
   automated match to d1zl2a_
   complexed with edo, na, peg

Details for d4of4b_

PDB Entry: 4of4, 1.4 Å

PDB Description: x-ray structure of unliganded uridine phosphorylase from yersinia pseudotuberculosis at 1.4 a resolution

PDB Compounds: (B:) Uridine phosphorylase

SCOPe Domain Sequences for d4of4b_:

Sequence; same for both SEQRES and ATOM records:

>d4of4b_ c.56.2.1 (B:) Uridine phosphorylase {Yersinia pseudotuberculosis [TaxId: 633]}
ksdvfhlgltkndlqgatlaivpgdpqrvekiaklmdnpvhlashreftswraeldgkav
ivcstgiggpstsiaveelaqlgvrtflrigttgaiqphinvgdvlvttaavrldgaslh
fapmefpavadfscttalvnaaksvgatthigitassdtfypgqerydtfsgrvvrhfkg
smeewqsmgvmnyemesatlltmcasqglragmvagvivnrtqqeipneetmkateshav
kivveaarhll

Timeline for d4of4b_:

• d4of4b_ first appeared in SCOPe 2.05
  
• d4of4b_ appears in SCOPe 2.07
  
• d4of4b_ appears in the current release, SCOPe 2.08