Lineage for d4oehd_ (4oeh D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1860688Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1860705Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1860706Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 1861107Protein Uridine phosphorylase [53176] (5 species)
  7. 1861337Species Vibrio cholerae [TaxId:243277] [224899] (8 PDB entries)
  8. 1861377Domain d4oehd_: 4oeh D: [269695]
    automated match to d4k6oa_
    complexed with edo, eoh, gol, na, peg, ura

Details for d4oehd_

PDB Entry: 4oeh (more details), 1.91 Å

PDB Description: x-ray structure of uridine phosphorylase from vibrio cholerae complexed with uracil at 1.91 a resolution
PDB Compounds: (D:) Uridine phosphorylase

SCOPe Domain Sequences for d4oehd_:

Sequence, based on SEQRES records: (download)

>d4oehd_ c.56.2.1 (D:) Uridine phosphorylase {Vibrio cholerae [TaxId: 243277]}
ktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvv
vcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhf
apmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgs
mkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsik
vvveaarkmlk

Sequence, based on observed residues (ATOM records): (download)

>d4oehd_ c.56.2.1 (D:) Uridine phosphorylase {Vibrio cholerae [TaxId: 243277]}
ktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvv
vcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhf
apmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgs
mkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkepdhatlketearsikv
vveaarkmlk

SCOPe Domain Coordinates for d4oehd_:

Click to download the PDB-style file with coordinates for d4oehd_.
(The format of our PDB-style files is described here.)

Timeline for d4oehd_: