![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
![]() | Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
![]() | Protein Uridine phosphorylase [53176] (6 species) |
![]() | Species Vibrio cholerae [TaxId:243277] [224899] (19 PDB entries) |
![]() | Domain d4oehe_: 4oeh E: [269694] automated match to d4k6oa_ complexed with edo, eoh, gol, na, peg, ura |
PDB Entry: 4oeh (more details), 1.91 Å
SCOPe Domain Sequences for d4oehe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oehe_ c.56.2.1 (E:) Uridine phosphorylase {Vibrio cholerae [TaxId: 243277]} ktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvv vcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhf apmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgs mkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsik vvveaarkmlk
Timeline for d4oehe_: