SCOPe 2.08: Domain d4ny7a1: 4ny7 A:2-251

Lineage for d4ny7a1 (4ny7 A:2-251)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.4: PqqC-like [101463] (2 proteins)
   Pfam PF05312

6. Protein Coenzyme PQQ synthesis protein C, PqqC [101464] (2 species)

7. Species Klebsiella pneumoniae [TaxId:272620] [189325] (4 PDB entries)

8. Domain d4ny7a1: 4ny7 A:2-251 [269691]
   Other proteins in same PDB: d4ny7a2, d4ny7b2
   automated match to d3hlxa_
   complexed with cl, gol, pqq; mutant

Details for d4ny7a1

PDB Entry: 4ny7, 1.44 Å

PDB Description: bond length analysis of the pqqc y175f mutant structure shows evidence for bound pqq in the reduced form

PDB Compounds: (A:) Pyrroloquinoline-quinone synthase

SCOPe Domain Sequences for d4ny7a1:

Sequence; same for both SEQRES and ATOM records:

>d4ny7a1 a.132.1.4 (A:2-251) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae [TaxId: 272620]}
litdtlspqafeealrakgdfyhihhpyhiamhngnatreqiqgwvanrfyyqttiplkd
aaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpgv
rfavdaylnfarracwqeaacssltelfapqihqsrldswpqhypwikeegyfffrsrls
qanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvtd
kaawhttrlv

Timeline for d4ny7a1:

• d4ny7a1 first appeared in SCOPe 2.05, called d4ny7a_
  
• d4ny7a1 appears in SCOPe 2.07