Lineage for d4ny7b1 (4ny7 B:2-251)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338543Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2338544Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2338765Family a.132.1.4: PqqC-like [101463] (2 protein domains)
    Pfam PF05312
  6. 2338766Protein Coenzyme PQQ synthesis protein C, PqqC [101464] (2 species)
  7. 2338767Species Klebsiella pneumoniae [TaxId:272620] [189325] (4 PDB entries)
  8. 2338771Domain d4ny7b1: 4ny7 B:2-251 [269689]
    Other proteins in same PDB: d4ny7a2, d4ny7b2
    automated match to d3hlxa_
    complexed with cl, gol, pqq; mutant

Details for d4ny7b1

PDB Entry: 4ny7 (more details), 1.44 Å

PDB Description: bond length analysis of the pqqc y175f mutant structure shows evidence for bound pqq in the reduced form
PDB Compounds: (B:) Pyrroloquinoline-quinone synthase

SCOPe Domain Sequences for d4ny7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ny7b1 a.132.1.4 (B:2-251) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae [TaxId: 272620]}
litdtlspqafeealrakgdfyhihhpyhiamhngnatreqiqgwvanrfyyqttiplkd
aaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpgv
rfavdaylnfarracwqeaacssltelfapqihqsrldswpqhypwikeegyfffrsrls
qanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvtd
kaawhttrlv

SCOPe Domain Coordinates for d4ny7b1:

Click to download the PDB-style file with coordinates for d4ny7b1.
(The format of our PDB-style files is described here.)

Timeline for d4ny7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ny7b2