![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.1: Cystatin/monellin [54403] (7 families) ![]() has a additional strand at the N-terminus |
![]() | Family d.17.1.0: automated matches [191407] (1 protein) not a true family |
![]() | Protein automated matches [190558] (13 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187545] (8 PDB entries) |
![]() | Domain d4n6nb1: 4n6n B:10-124 [269687] Other proteins in same PDB: d4n6nb2 automated match to d1tija_ complexed with iod |
PDB Entry: 4n6n (more details), 1.87 Å
SCOPe Domain Sequences for d4n6nb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n6nb1 d.17.1.0 (B:10-124) automated matches {Human (Homo sapiens) [TaxId: 9606]} vgelrdlspddpqvqkaaqaavasynmgsnsiyyfrdthiikaqsqlvagikyfltmemg stdcrktrvtgdhvdlttcplaagaqqeklrcdfevlvvpwqnssqllkhncvqm
Timeline for d4n6nb1: